Intelligent Computing Lab.
Bioinformatics in NCTU, Taiwan.
Home

AbAmyloid: Prediction and analysis of antibody amyloidogenesis from sequences

Home | Test data | Help | Developer || Release 1.0, Last update: Jan 14 2013 

Test data


>J00248 (Non-Amyloidogenic)
DIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWFQQKPGKAPKSLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSYP
>AAC97098 (Amyloidogenic)
DIVMTQSPSSLSASVGDRVTITCRASQDISNYLAWFQQKPGKAPKSLIYSASNLQAGVPSNFSGGGSGTDFTLTISSLQPEDFATYYCQQYKSYP