Intelligent Computing Lab.
Bioinformatics in NCTU, Taiwan.
Home

ProLoc:
  Prediction of protein subnuclear localization utilizing evolutionary support vector machine with physicochemical composition features

Home | Download || Release 0.9, Aug 16 2006 


Please paste sequence(s) in FASTA format.

Or upload a sequence file (FASTA format).



An example of FASTA format:

>O60563;
MEGERKNNNKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQRLNVSQLTIN TAIVYMHRFYMIQSFTQFPGNSVAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPD TRSEAYLQQVQDLVILESIILQTLGFELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATN SLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHE FLQILEKTPNRLKRIWNWRACEAAKKTKADDRGTDEKTSEQTILNMISQSSSDTTIAGLM SMSTSTTSAVPSLPVSEESSSNLTSVEMLPGKRWLSSQPSFKLEPTQGHRTSENLALTGV DHSLPQDGSNAFISQKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENMEANVKSQYAY AAQNLLSHHDSHSSVILKMPIEGSENPERPFLEKADKTALKMRIPVAGGDKAASSKPEEI KMRIKVHAAADKHNSVEDSVTKSREHKEKHKTHPSNHHHHHNHHSHKHSHSQLPVGTGNK RPGDPKHSSQTSNLAHKTYSLSSSFSSSSSTRKRGPSEETGGAVFDHPAKIAKSTKSSSL NFSFPSLPTMGQMPGHSSDTSGLSFSQPSCKTRVPHSKLDKGPTGANGHNTTQTIDYQDT VNMLHSLLSAQGVQPTQPTAFEFVRPYSDYLNPRSGGISSRSGNTDKPRPPPLPSEPPPP LPPLPK

Contact with:
Wen-Lin Huang, Shinn-Ying Ho.

Reference:
Huang, W.-L., Tung, C.-W., Huang, H.-L., Hwang, S.-F. and Ho, S.-Y. (2007) ProLoc: Prediction of protein subnuclear localization using SVM with automatic selection from physicochemical composition features, Biosystems, 90, 573-581.